PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G141200.3
Common NamePHAVU_005G141200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 176aa    MW: 19717.8 Da    PI: 4.9488
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G141200.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-16243548
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
  Phvul.005G141200.3  2 TPQEERLVLELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTLM 43
                        9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.7E-12145IPR001005SANT/Myb domain
PROSITE profilePS5129424.915147IPR017930Myb domain
CDDcd001671.61E-12143No hitNo description
SuperFamilySSF466891.33E-12248IPR009057Homeodomain-like
PfamPF002491.4E-14242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-19244IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MTPQEERLVL ELHSKWGNRW SRIARKLPGR TDNEIKNYWR TLMRKKAQDK KRGEAASFTP  60
TPSSSVHSSI SVSSKKHAVE PHGSKKAGEE SFYDTGGPSV IGSSQDEGEG EFSMDDIWKD  120
IDMSEENNSF LHGNGEVVSP SPSSWEYCSC EPLWVMDEES LFCPMSEPYF YALSG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-93AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007150290.11e-128hypothetical protein PHAVU_005G141200g
SwissprotQ9LX823e-39MYB48_ARATH; Transcription factor MYB48
TrEMBLV7BWG71e-128V7BWG7_PHAVU; Uncharacterized protein
STRINGGLYMA15G04620.15e-76(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.27e-41myb domain protein 48